PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr005109.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 642aa    MW: 70819.8 Da    PI: 5.2057
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr005109.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS306.27.8e-942676402374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  +++L+++Ae +++g+  laq +Larl+++ sp g+p+ R a+yf+eAL+  l+  ++s++++al+p      + + ++ a+k fse+sP++ f+++t+
  Pbr005109.1 267 IDQLFNAAELIETGNSVLAQGILARLNHQLSPIGKPFSRTAFYFKEALQFLLNTnTSSNCSSALSP-----FSLIFKIGAYKSFSEISPVVHFANFTC 359
                  689*************************************************99333444444333.....3479*********************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...............skeeleetgerLakfAeelgvpfefnvl 181
                  NqaIleaveg +rvH+iDfdi++G+QW++++q+ a R++g psl+iT++ s++++               ++ e++ t+e+L++fA+el++ fe +++
  Pbr005109.1 360 NQAILEAVEGFNRVHVIDFDIGYGGQWASFMQEVALRNGGVPSLKITAFISSSTHdefevsftrenlsthDEFEVSFTRENLEHFASELNLAFELELV 457
                  ************************************************999888889***********99999************************8 PP

         GRAS 182 vakrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                     +le+l+  +L +     E +aV + l + ++ ++++sl+     +L++vk+lsP++vv  ++ +d+++ +F +++++al+ ys l++s++a    
  Pbr005109.1 458 ---SLESLNSGSLGLPLhaSEGVAVAVNLPIGSFSNNPLSLPL----ILRFVKQLSPRIVVSLDRGSDRTDVPFPHQIIQALYSYSGLLESIDAA-NV 547
                  ...7888888887554444888888888888999999999999....*********************************************665.34 PP

         GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  + ++ +k+Er ll++ i+++v+  +       ++  +Wr  + ++GF+p+++s+++++qa++l++++++ g+++e+++ slvl+W+ + L+s+SaWr
  Pbr005109.1 548 NPDALQKIERYLLQPGIEKIVTGCHLL----PKRTPSWRTLFLSSGFSPLTFSNFTESQAECLVQRTPVGGFHIEKRQSSLVLCWQCKDLISASAWR 640
                  668999***************988887....89999************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.29240620IPR005202Transcription factor GRAS
PfamPF035142.7E-91267640IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    Send to blast
MEDWESVLSE SPGQEQSILR LIMSDIEDPS LGLNTLLQSS SGSDHLHQDL EFSGGGFQDV  60
VDQGGYGGGF EPNNNSGSLV SPSLHASSGP DFNFSNNASN VETRSSNVRP NHAIFSASMS  120
NPFLVSQSSG MFQQQQSMGL DEKPQIFNPQ MVINQNQAQF AQHPAMFMPL TYAQLQEHHL  180
LSPPPSKRLN SGELGPSYPV QRVPFSNPGQ ELVVRAQQQL QFLPQHLQQQ RPTMPVAKEK  240
MMSPAEGCKE MMNQNQLQQQ QFQQAVIDQL FNAAELIETG NSVLAQGILA RLNHQLSPIG  300
KPFSRTAFYF KEALQFLLNT NTSSNCSSAL SPFSLIFKIG AYKSFSEISP VVHFANFTCN  360
QAILEAVEGF NRVHVIDFDI GYGGQWASFM QEVALRNGGV PSLKITAFIS SSTHDEFEVS  420
FTRENLSTHD EFEVSFTREN LEHFASELNL AFELELVSLE SLNSGSLGLP LHASEGVAVA  480
VNLPIGSFSN NPLSLPLILR FVKQLSPRIV VSLDRGSDRT DVPFPHQIIQ ALYSYSGLLE  540
SIDAANVNPD ALQKIERYLL QPGIEKIVTG CHLLPKRTPS WRTLFLSSGF SPLTFSNFTE  600
SQAECLVQRT PVGGFHIEKR QSSLVLCWQC KDLISASAWR C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-2628464021375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009349895.10.0PREDICTED: scarecrow-like protein 6, partial
SwissprotO813161e-136SCL6_ARATH; Scarecrow-like protein 6
TrEMBLM5X7H70.0M5X7H7_PRUPE; Uncharacterized protein
STRINGVIT_15s0048g00270.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF31833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-126GRAS family protein